SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490612|ref|YP_003720789.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490612|ref|YP_003720789.1|
Domain Number 1 Region: 221-445
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.65e-64
Family CAT-like 0.00012
Further Details:      
 
Domain Number 2 Region: 19-111
Classification Level Classification E-value
Superfamily Single hybrid motif 1.05e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00044
Further Details:      
 
Domain Number 3 Region: 142-186
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000183
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490612|ref|YP_003720789.1|
Sequence length 452
Comment hypothetical protein Aazo_1439 ['Nostoc azollae' 0708]
Sequence
MIWQQLVKFHKIIDSETTIMSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVE
SDKADMDVESFYEGFLAHIIVQAGETAPIGAAIAYVAQTEAEIEAAKTMAGGGSAVAQTH
TPIPAAPTVATTATPSQNGSNHREERLVVSPRARKLAKELQVDLNNLKGSGPYGRIVAED
VEAAVGKVQPPTTRAVTPTQPTPPVIPAPPPAPAKPAAVTAPVVSSAVPGQVVPLTTLQN
TVVRNMVTSLSVPIFHVGYTITTAALDKLYKQIKSKGVTMTALLAKAVAVTLEKHPLLNA
SYSDQGIVYHPNINISVAVAMDDGGLITPVMQKANQVDIYSLSRNWKSLVDRARAKQLQP
EEYNSGTFTLSNLGMFGVDTFDAILPPGQGSILAIAASRPQVVATADGLFGVRKQMKVNI
TCDHRIIYGAHAATFLQDLAKLIETNPQSLIL
Download sequence
Identical sequences D7E3Z8
gi|298490612|ref|YP_003720789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]