SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490621|ref|YP_003720798.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490621|ref|YP_003720798.1|
Domain Number 1 Region: 118-213
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-17
Family FKBP immunophilin/proline isomerase 0.0044
Further Details:      
 
Domain Number 2 Region: 7-155
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.000000000000569
Family Porin chaperone SurA, peptide-binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490621|ref|YP_003720798.1|
Sequence length 252
Comment PpiC-type peptidyl-prolyl cis-trans isomerase ['Nostoc azollae' 0708]
Sequence
MEPSSFFTINDEQIDLYQVIQYLQVSGKLNQFISDVLRQYVLEQELETRNDIEISTALIE
QAIIDYRLKNQLTDPEQFQKWLKNNGSDYATFHASVTFSFKLEKLKALIVEPKLPEYFIE
RKIYLDRVVLSRIMVDNRELAEELHTQIEEGGSFEQLAKEYSLADERIFNGMMGPISRGS
LPDILRAAVDAATPGKLIGPIELEGSLSLFRLENILPASLENTQFKQSLQNELFEKWLGE
KIQNLTVKLQVS
Download sequence
Identical sequences D7E407
gi|298490621|ref|YP_003720798.1| WP_013190693.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]