SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490627|ref|YP_003720804.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490627|ref|YP_003720804.1|
Domain Number 1 Region: 1-243,337-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-38
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 243-333
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000262
Family D-aminoacid oxidase-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490627|ref|YP_003720804.1|
Sequence length 379
Comment FAD dependent oxidoreductase ['Nostoc azollae' 0708]
Sequence
MNVVIIGCGVVGAAIAYQLSQVKGLNITVFDQNQPAQASTGAALGVLMGVISHKIKGKAW
QMRQESIQRYETLIPELEGITGRKIPCNRQGIVMLLSEDSEHPLASGVEAITEWEQLREI
RKAQGWQLAVWDKDKLQKFCPQINHPTIIGAVYSPQDRQLNPTALTLAFVDAAQRNGVKF
KFGVAVNNKQAPSSQLIQILPRFTEQLKSIETSEGTVNADWFIVAAGLGSTAITAQLNHK
VHIRPVLGQALYLSLGRILGNPDFQPVITGNDIHLVPMGSGDYWVGATVEFPNDADEIFA
NKELLESLQKQALAFCPDLASAKVVRTWSGLRPRPENRPAPVIDKLPGFSNVLLATGHYR
NGVLLAPATALAVQNMIIS
Download sequence
Identical sequences D7E413
WP_013190699.1.25658 gi|298490627|ref|YP_003720804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]