SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490648|ref|YP_003720825.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490648|ref|YP_003720825.1|
Domain Number 1 Region: 4-199,300-390
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.88e-83
Family Bacterial dinuclear zinc exopeptidases 0.0000183
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 9.81e-30
Family Bacterial exopeptidase dimerisation domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490648|ref|YP_003720825.1|
Sequence length 396
Comment amidohydrolase ['Nostoc azollae' 0708]
Sequence
MLTRIKDLATNLAPRLLEIRRHIHSHPELSGQEYQTAAFVAGVLSSSGLHVVEGVGKTGV
IGELQGTQHNEKVLAIRTDMDALPIQERSGLEYASRNMGVMHACGHDAHTTIGLGTAMVL
SQIAEELGGKIRFLFQPAEEIAQGASWMVKDGVMNHVSAILGVHVFPSIPAGYVGIRYGA
LTAAADDLEIMIIGESGHGARPHEAIDAIWIACQVITSLQQAISRTQNPLRPVVLSIGKI
HGGRAPNIIADQVQLLGTVRSLHPETRTQLPSWIENIVANVCNSYGAKYQVNYRQGVPSV
QNDYALTKLLQSSAEEAWTTDRIQVLPEPSLGAEDFSVYLEHAPGSMFRLGVGYQDRSIN
HPLHHPQFEVDESAIVTGVVTLAYAAYKYWKISRTT
Download sequence
Identical sequences D7E4E4
gi|298490648|ref|YP_003720825.1| WP_013190720.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]