SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490667|ref|YP_003720844.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490667|ref|YP_003720844.1|
Domain Number 1 Region: 301-600
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.44e-88
Family DNA repair protein MutS, domain III 0.00000124
Further Details:      
 
Domain Number 2 Region: 602-842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.34e-56
Family ABC transporter ATPase domain-like 0.000000558
Further Details:      
 
Domain Number 3 Region: 137-201,231-313
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 5.49e-41
Family DNA repair protein MutS, domain II 0.00041
Further Details:      
 
Domain Number 4 Region: 22-135
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.79e-36
Family DNA repair protein MutS, domain I 0.0000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490667|ref|YP_003720844.1|
Sequence length 854
Comment DNA mismatch repair protein MutS ['Nostoc azollae' 0708]
Sequence
MTTPTPEHNQPNTPLRDTKLVEDRSKLSKMYQHYVEMKDKYPHALLLYRVGDFFETFFQD
AVTVSRELELVLTSKHGGELGRIAMTGVPHHAWERYTTLLVEKGYAVVICDQVEDSSEAV
GLVKREVTRILTPGTLLEEGMLQTSRNNYLAAVVIAVNHWGLAYADISTGEFLTCEGSDL
EHLTQELMRLQPSEVLFPTNAPDLGTLLRPGETSPSLPQCLPPTFCYSLRSQLPFSQSEA
RSKLLQKFKLRSLEGLGCEHLPLAVRAAGGLLEYIEDTQKQNPVPLQLLHTYSLTDYLIV
DHQTRRNLEITQTVRDGTFHGSLLWALNRTTTAMGGRALRRWLLQPLLDIKGIRARQYTI
QELCENTPLRQDLRRLLRKIYDLERLTGRAGSGTANARDLMALADSFSSLPELSRIVEDA
RSPFLKALQKVPPVLEELAERLQAHIVESPPIHLKEGSLIRPGINPLLDERKATVEADQK
WIANLEVDERARTRIPTLKVGFNKTFGYYISISRSKSDQVPDNYIRKQTLTNEERYITPD
LKEREARILTARDDLNQLEYEIFAALRDEVGSHAETIRNISHAVAAADVLCGLAELAVHQ
GYCCPEMVEGWEIEVIDGRHPVVEQSLPAGFFVPNSTTLGTGNEPTNHQSPDLVILTGPN
ASGKSCYLRQVGLIQLMAQVGSFVPARSAKLGVCDRIFTRVGAVDDLATGQSTFMVEMNE
TANILNHATVKSLVLLDEIGRGTATFDGLSIAWAVAEYLAVEIKSRTIFATHYHELNELA
SIVSNVANYQVTVKELPDQIIFLHQVQPGGADKSYGIEAGRLAGLPTVVIKRAKQVMGQI
EKHSKIAVGLREGL
Download sequence
Identical sequences D7E4G3
gi|298490667|ref|YP_003720844.1| WP_013190739.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]