SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490702|ref|YP_003720879.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490702|ref|YP_003720879.1|
Domain Number 1 Region: 206-453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.25e-63
Family Tandem AAA-ATPase domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-43
Family Tandem AAA-ATPase domain 0.00000374
Further Details:      
 
Domain Number 3 Region: 528-602
Classification Level Classification E-value
Superfamily HRDC-like 7.41e-24
Family HRDC domain from helicases 0.0014
Further Details:      
 
Domain Number 4 Region: 622-676
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000714
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490702|ref|YP_003720879.1|
Sequence length 722
Comment ATP-dependent DNA helicase RecQ ['Nostoc azollae' 0708]
Sequence
MLKYPQLEKALKYHFGYDQFRPGQRQIIEDALQNRDLMVVMPTGGGKSLCFQLPALLKSG
LTVVVSPLIALMQDQVEALRNNNISATFLNSSLNFYKVRSREEAIMNGKVRLLYIAPERL
ISDKFLPLLDVVKEKIGIANFAIDEAHCVSEWGHDFRPEYRQLILLKKRYPDVTTTALTA
TATDRVRVDIIQQLGLKQPSVHIASFNRHNLYYEVRSKNQRAYAELLEIVRENKGSGIIY
CLTRKKVDELTFKLQNDKIAALPYHAGLSDDERSKNQTRFIRDDIRVMVATIAFGMGINK
PDVRFVVHFDLPRNLESYYQESGRAGRDSEPSRCTLFFSFGDVKTIEWSINQKTDLQEKL
IAKQQLRQVIDYAEGTDCRRTIQLAYFGERFPANCGNCDNCLYPKPVQNWTIEAMKFLSC
VARCKERYGMLYIIDVLRGAKNQKITLNKHDQLSTYGIGKDKTLDEWRILGRSLLHQGLL
EQTTDGYSVLKLNALSWEVMRKQRSVSIAVPIAQKISLEEGNAKAAEVEVLMHRLRSLRK
QLADEQAVPPYVIFHDSTLKLMAQIQPKTLHEFGKLSGVGSHKLAQYGDRFLAEIQAYCQ
QQSLQPQKTNPVYYAPVDNFPSDTESTTLKLYEQGFNIQEIAQKRNVKTSTIIQHLSDLI
EKNQSIDLNQLIPLERQKKIWQVLDVLGDIALKPIKDYLGESYSFNEIRLVKAKWQRENR
KT
Download sequence
Identical sequences D7E4J8
gi|298490702|ref|YP_003720879.1| WP_013190774.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]