SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490736|ref|YP_003720913.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490736|ref|YP_003720913.1|
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.76e-19
Family Hypothetical protein TM1112 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490736|ref|YP_003720913.1|
Sequence length 90
Comment hypothetical protein Aazo_1616 ['Nostoc azollae' 0708]
Sequence
MEIKIEHQPTQESLKQLGVYKWAIWQKEVSKFPWTYDSQETCYFLEGNVIVTPDGGQPVQ
IGKGDLVTFGAGMCCTWEITQDVKKHYCFD
Download sequence
Identical sequences D7E4Z3
gi|298490736|ref|YP_003720913.1| WP_013190808.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]