SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490843|ref|YP_003721020.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490843|ref|YP_003721020.1|
Domain Number 1 Region: 13-138,249-345,730-948
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.06e-125
Family Calcium ATPase, transmembrane domain M 0.0000496
Further Details:      
 
Domain Number 2 Region: 349-369,533-786
Classification Level Classification E-value
Superfamily HAD-like 2.07e-61
Family Meta-cation ATPase, catalytic domain P 0.0000528
Further Details:      
 
Domain Number 3 Region: 358-582
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.98e-60
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0005
Further Details:      
 
Domain Number 4 Region: 138-248
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.92e-27
Family Calcium ATPase, transduction domain A 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490843|ref|YP_003721020.1|
Sequence length 953
Comment HAD superfamily ATPase ['Nostoc azollae' 0708]
Sequence
MSAHSLPEGAAVWHSLEVDKALELLDSNADSGLTPQEVEQRLQKYGLNELEEQGGRSPWE
ILLDQFTNIMLLMLIGVALISGFLDFMAWQQGTLRTGEVPFKDTIAIMAIVSLNGILGYV
QESRAEKALAALKKLSSPLVRIIRDGKLADVPGKELVPGDVMLLEAGVQLAADGRLIEQS
NLQVRESALTGEAEAVNKQAKLTLPEDTALGDRINLVFQGTEVVQGRAKVLVTNTGMTTE
LGKIATMLQSVESEPTPLQQRMTQLGNVLVTGSLVLVAIVLVGGIIQARGFTNLQELLEV
SLSMAVAVVPEGLPAVITITLALGTQRMVRHNALIRKLPAVETLGSVTTICSDKTGTLTQ
NKMVVQLVYTNHKNFRVTGEGYAPVGDFQLNGQKVDPDENPEISALLVACAMCNDSVLQK
EAGEWAILGDPTEGALMTLGGKAGIEKDQWHSKLPRVSEFPFSSERKRMSVICQVEEVVT
VDPAMSGVDPLIAGFLESEPYLMFTKGSPELTLARCNRIYLGDRSIPIDEEQRTQISVAN
DYMASQGLRVLGFAYKPLTDVPTEASEDISEQDLVWLGLVGMLDAPRPEVRDAVKECRQA
GIRPVMITGDHQLTARAIAVDLGIADADARVLTGQELQRMSDTELKEKVDLVSIYARVSP
EHKLRIVQALQRRGRFVAMTGDGVNDAPALKQADIGIAMGITGTDVSKEASDMVLLDDNF
ATIVAATKEGRVVYTNIRRFIKYILGSNIGEVLTIAAAPILGLGGVPLTPLQILWMNLVT
DGLPALALAVEPPELDVMQCPPFSPRESIFARGLGSYIVRIGIVFAIITIILMEWAYFHV
RTATAEGLDPERWKTMVFTSLCLAQMGHALAIRSNNQLTIEMNAFSNPFVLGAVVATTIL
QLMLVYVPPLQAFFGTHYLPLDELLVCIGFSALMFVWIEGEKIFFRLMGKRSV
Download sequence
Identical sequences D7DVN8
gi|298490843|ref|YP_003721020.1| WP_013190915.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]