SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490931|ref|YP_003721108.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490931|ref|YP_003721108.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.18e-79
Family Histidine biosynthesis enzymes 0.000000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490931|ref|YP_003721108.1|
Sequence length 257
Comment imidazoleglycerol phosphate synthase cyclase subunit ['Nostoc azollae' 0708]
Sequence
MLSKRILPCLDVKAGRVVKGINFVDLKDAGDPVELAKVYNEAGADELVFLDITATHEDRD
TIVDVVYRTAEQVFIPLTVGGGIQTLENVKGLLRAGADKVSINSAAVRNPDLINQASDRF
GNQCIVVAIDARRRLNPENPGWDVYVSGGRENTGIDALYWAEEVTKRGAGELLITSMDAD
GTQAGYDLELTRVIAQSVQVPVIASGGAGNCEHIHDALTTGKAEAALLASLLHYGQLSVA
QIKTYLLERSVPVRIPC
Download sequence
Identical sequences D7DVX6
gi|298490931|ref|YP_003721108.1| WP_013191002.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]