SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490942|ref|YP_003721119.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490942|ref|YP_003721119.1|
Domain Number 1 Region: 131-319
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.06e-50
Family ATP-binding domain of peptide synthetases 0.0000683
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.63e-35
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490942|ref|YP_003721119.1|
Sequence length 320
Comment glutathione synthetase ['Nostoc azollae' 0708]
Sequence
MKLAFIIDPIHQLDPGHDTSVALMEAAQKLGHGVWVTQTNLLSVVKGKAWALLQQVELVP
VEVVEGRWLAANPWYNLRECSFTLLETMDAVFMRTDPPVNDAYLYATYTLDYIDQNKTLV
INNPSGIRAANEKMYALQFSQCIPETIVSADKQVIRQFVEAKGSTVLKPLGNKAGEGILF
LQSGDRNFNSIVELSTLQGRLPVMVQNYLPEAKEGDKRIILLNGKPIGALNRLSSGSDFR
NNMAAGGTVAQTEITPREQEICGLLADKLSQDGLIFVGIDVIGGYLTEVNVTSPTGIREI
DRLDGTCLGHQVIQWLEKKV
Download sequence
Identical sequences D7DVY7
WP_013191013.1.25658 gi|298490942|ref|YP_003721119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]