SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490970|ref|YP_003721147.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490970|ref|YP_003721147.1|
Domain Number 1 Region: 217-792
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.83e-175
Family Acetyl-CoA synthetase-like 0.0000000068
Further Details:      
 
Domain Number 2 Region: 1291-1878
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.27e-157
Family Acetyl-CoA synthetase-like 0.0000000109
Further Details:      
 
Domain Number 3 Region: 2378-2951
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.32e-154
Family Acetyl-CoA synthetase-like 0.00000000723
Further Details:      
 
Domain Number 4 Region: 1055-1317
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.89e-68
Family CAT-like 0.093
Further Details:      
 
Domain Number 5 Region: 2142-2406
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.45e-68
Family CAT-like 0.083
Further Details:      
 
Domain Number 6 Region: 3003-3289
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.62e-54
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.002
Further Details:      
 
Domain Number 7 Region: 1957-2134
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.11e-49
Family NRPS condensation domain (amide synthase) 0.0067
Further Details:      
 
Domain Number 8 Region: 870-1047
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 9.67e-47
Family NRPS condensation domain (amide synthase) 0.016
Further Details:      
 
Domain Number 9 Region: 11-248
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.56e-31
Family NRPS condensation domain (amide synthase) 0.023
Further Details:      
 
Domain Number 10 Region: 1857-1930
Classification Level Classification E-value
Superfamily ACP-like 6.15e-22
Family Peptidyl carrier domain 0.0022
Further Details:      
 
Domain Number 11 Region: 771-844
Classification Level Classification E-value
Superfamily ACP-like 1.19e-21
Family Peptidyl carrier domain 0.0018
Further Details:      
 
Domain Number 12 Region: 2932-3004
Classification Level Classification E-value
Superfamily ACP-like 3.93e-20
Family Peptidyl carrier domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490970|ref|YP_003721147.1|
Sequence length 3291
Comment amino acid adenylation domain-containing protein ['Nostoc azollae' 0708]
Sequence
MKIIEDIYLDSYSSSEKFWRAFLRGFTAPITLPMLTPDSLSHPSRQTKEVRLLGSKTSDL
ITFAQNHKLTLYTFIQGAVAILLSHYTRETDILFGAMIKELDFNIVPMRISVEADASVLS
WLTELQTQCYFLGEYKSTPLLQIQQWSEIPPEVPLFETLLICGNYENIEHLEEARYLLIL
SIDAESDLLLRINYQQTQFADDAIDRMLGHLETILTNIIALPEQTLANIPLLTEWERHQL
LVEWNQTQTDYPQDKCIHELFEEQVAKTPDTVAVVFENEKLTYRELNQRANQLANYLQSL
GVQPEFLVGICTERSIEMIVGILGILKAGGAYVPLDIAYPKERLAFILSDSQLSIILTQQ
HLVERLPRNQARVVCLDNDWEDIVKIPIQHTEITVEPDNLAYIIYTSGSTGKPKGVIILH
HNVVCLFAATQPWFQFNNNDVWSCFHSYAFDFSVWEIWGALLYGGRLVIIPYYVSRSPEL
FYKLLSQEGITILNQTPSAFKQLIQLETSLNNHSDLSLRFVIFGGEALDIQSLKPWVDKH
RDKFTQLVNMYGITETTVHVTYRPINIDDLNSSPKVIGCAIPNLQLYILNSHLQPVPVGV
AGEIYVGGAGLARGYLNNLELTAERFIPHPFNNQAKARLYKTGDLARYLPSGDIEYLGRI
DNQVKIRGFRIELGEIEALLNQHPNLREAKVISREDIPGDKRLVAYVITNLQENNQGEIS
QKIREYLKEKLPDYMIPSAFVVLDTFPLTPNGKIDHRALPTVNFLATQSNYVAPRTPTEE
IIAQIWSQVLKVETIGMNENFFELGGHSLLATQVISRIRQTLSLELSLLLLFEYPTIAQI
SEQISNTEQTNNPVLESPIDTRNPQIKLSLSFAQQRIWFLDQLQPDSTAYNLSYSFQIKG
KLNISTLKKCIGEIVQRHEILHTNFVAIDGQVTQVITNNIEFNLPIIDLQILTNKQRKIE
AQKITKEEAEKPFNLAEGSLFSVKLLQLSAEDFLMLFNIHHIIFDGWSFGVLFDELKVLY
TAYYEGLISPLPKLSIQYADFSLWQRKWLTGAILESQLNYWQQQLGGNLPILELPTDRLR
PRVQSYQGAIKTFILYPELTASITSFAQKEAVTLFMTLLTAFKVLLCRYSGQEDVIVGTP
IAGRNRREIEGLMGFFVNTLALRTDLGNNPSFNELLSRVRRICLEAYTHQDVPFEQLVEI
LQRERNLSHTPIFQVMFALQNEPMGELQLPDLTLTPLKPAVQTAKFDLTLSMEERNGQLI
GEWEYNTDLFDDSTIERMSEHFKILLSGILTDSNQNIWQLPLLTEAEKHQLLLEWNQNKI
NYSQTKWTHKLFEEQVEKTPHAIAVIFEEQKITYQELNQRANQLANYLQKLGVNADKLVG
LCLEISLARIIGLLAILKAGGVYVPLDPVYPQERLRFIIEDAQVSILLTQESLADKFLIN
SLQVVNLDGDWEKIATESTNNLQSCLTGENLAYVIYTSGSTGTPKGVLIEHQAIAYHCQN
IVEHYQLNASDRILQSVSLSFDVSLEQILPTLTVGATVILVDAQSLTPWEFHRKLIDYSL
TVIAIPIAYLTQWLQSLDENTYAIDINELRLVICGGEVLPPGILKIWYNSPMKGICLINA
YGPTETSITAITFTIPQNIKLIESYTNIPIGRPLPNRRIYILDHHKNSVPIGVAGELYIG
GIGLARGYLNRPELTDEKFVPSPFDNSRLYKTGDVASYLPDGNIQFLGRTDSQVKIRGFR
IELGEIEAILNQHPNVKAARIITREDIPGDQRLVAYIIPNFSTEVTGTSKQKKFNQEFTS
LQLEIPYQIRNYLKQQLPDYMIPAAFVVLETFPLTTNGKINHCALPAPDFWAAQSNYVAP
RTPTEEIIVQIWSQVLKVENIGIDDNFFELGGHSLLATLLISRLRQTFNQEIPLILLFEY
PTVSQLYEQIRITERENNSLLLPPIEPTIQRKENLPLSFSQKRLWFLAQLEPNSTAYTMP
LTLRLQGLLNITALERSIAVIIKRHEILRTNFISTDGQPIQVITKNINWDLPITDLQLLP
DEQRDIEAAKISQQEAETPFNLAEDRLVRVKLLRLSAEEYLLIFNIHHIIFDGWSFGVLF
AELKAIYTSYCQGLTSALPQLYIQYADFILWQRQWLTRKFLESQLVYWQQQLGGILPILK
LPIDRPRPRIQTYIGATKSFIFSKELTASLKSLYQEEGVTLYMVLLTTFKVLLCRYSGQE
DVIVGTPIAGRNRRELEGLMGFFVNTLALRTDLGNNPSFNELLSRVRRVCLEAYTHQDLP
FEQLVEVLGPERDLSHTPVFQVMFTLQNSLMGELQLPDLTVTTLEPAVQTAKFDLTVSLT
EENGQLIGEWQYNTHLFDTSTIERMIEHFQMLLSGILTDSNQKIWQLPLITEQERHQLLV
EWNQTQKDYPHDKCIHHLFAEQAEKTPDAVAVVFKNQQITYGKLNQRANQLANYLQTLGV
QPEVLVGIYTERSIEMVIGLLGILKAGGAYVPLDINYPTERIYRMLDDAKVGVLLTQKHL
LAKINQLPLVAENKLVVGSLDEDIQDLLSGNTLKSPHCKNLAYVIYTSGSTGKPKGVGVE
HGQLLNYVKGILDRLDLPTAANFATVSPFFTDLGNTMIFSALCIGGCLHIIAEEVATDPV
AFTKYNQSYFLDCLKIVPSHLSSLLTGSEPEKLLPRQRLILGGEAASWELIKRVNKLAPK
CQIFNHYGPTETTVGVLTYPLGSASTEALSNTVLLGRPLVNTQIYVLDQYRQPVPLGVSG
EIYVGGDSVARGYINRSELTAERFIPNLFSNEPDAKLYKTGDLARYLSDGNLEFLGRIDD
QVKIRGFRIELGEIEAVLNQHPSLRETKVITREDIPGKERLIAYIIPTYDQNSPLEISHK
IRKYLKQQLPDYMIPAAFVVLESFPLTANGKIDYYNLPIPDFRNLESEGNLQPADNLELQ
LIKIWENVLGIQPIGLSDNFFDLGGHSLLAVTLFAQIHKTFGKNIPLTYLFQCPTIRQLA
NVLRQEGCSTLWSSLVPIQTKGSKPPFFYIHTASGGLIHSLNLLSKLDADQPVYGLQAQG
LDGKSSPHTCIEDMASHYIQEIQTIQLHGPYLLGGWCAGGMIAYEMAQQLHAQGESVKLL
TIFDAYPLQMIPTDNTVLNPYFSIKTVSRTYSSIMDMIKRNRSYFGHLTFKQQIIAIWEK
INRRIQDMIKDNLYQFYVKRNLPLPHALSNLAVRDAIVRAYRSYCPQVYPGKIIFFRAID
HMEEYARHMEKWEELATASVEIHDISGNHDSIMSEPHVLVLAQKLKDCLNR
Download sequence
Identical sequences D7DWA7
gi|298490970|ref|YP_003721147.1| WP_013191041.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]