SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491029|ref|YP_003721206.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491029|ref|YP_003721206.1|
Domain Number 1 Region: 174-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-115
Family Leucine aminopeptidase, C-terminal domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 1-177
Classification Level Classification E-value
Superfamily Macro domain-like 1e-37
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491029|ref|YP_003721206.1|
Sequence length 490
Comment leucyl aminopeptidase ['Nostoc azollae' 0708]
Sequence
MTIQPTNTALLDWTGDTLAVGLFEDAVDLTGDLAILNDNLGGLLKELIAEEEFTGKANST
IVARVGAGHPVRKVILVGLGKPDALKLETLRCLAATVARTAKKQKTKTLAISLPVWNNDQ
AATGQAIAEGTQLALYQDIRFKSEPEDKNPPIETIDLLGLGGQEAAITRAEQIVSGVILA
RQLVAAPANAVTPITMAETAKAIAKDHGLHLEILEQEECEKLGMGAFLGVAQASDLPPKF
IHLIYKPATTPKRKLAIIGKGLTFDSGGLNIKGAGSGIETMKIDMGGAAATLGAAKAIGQ
LKPDVEVHFISAVTENMISGRAMRPGDILTASNGKTIEVNNTDAEGRLTLADALVYADKL
GVDAIVDLATLTGACVVALGDDIAGLFTPDDAVASQLQTASESAGEKLWRLPMEEKYFEG
LKSGIADMKNTGPRYGGSITAALFLKQFVKDTPWAHLDIAGPVWADKENCYNGAGATGFG
VRTLVNWVLS
Download sequence
Identical sequences D7DWG6
gi|298491029|ref|YP_003721206.1| WP_013191100.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]