SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491100|ref|YP_003721277.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491100|ref|YP_003721277.1|
Domain Number 1 Region: 58-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.79e-34
Family Phosphate binding protein-like 0.00027
Further Details:      
 
Weak hits

Sequence:  gi|298491100|ref|YP_003721277.1|
Domain Number - Region: 756-830
Classification Level Classification E-value
Superfamily NHL repeat 0.0915
Family NHL repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491100|ref|YP_003721277.1|
Sequence length 903
Comment hypothetical protein Aazo_2133 ['Nostoc azollae' 0708]
Sequence
MWQQEKKDGVIVNLVLSLALATSGVVANLFVLAPTQAELKSDFTTFPLPQTVEDGIKVRI
DGSASLVMINQSLKDTFENQFSGTQIEVGVNSADADAALKTLLEGKIDIAAIARDLTPAE
KARGLEQVHLHREKIAIIVGANNPFPGSLTPEKFAKIFRGQIKDWSELGVQSGKIRLINR
PSTSNTHNAFRDYSVFQTAEFPTRTNPTQIAEDKTAQIIQQLGTDVISYVIANQVSKLLD
VRVLKIKGVTPGNSQYPFSQPLVYVYKQNPNPGVVGFLSLTLAPVRKKALEPPREAEASA
IAASSLQSVNRETLTTSSSKPQPLLTVAPSENSTISTTPQSQTPINTLGSGNEQQFVSPL
ENDPLEDKNVILLIVLSLLPIFGLGGFLTWWFKRKLRSVDEKTDNLETLISSTSTTETIS
ITPDDYSILPYLENGSCTNGISHLNQTTTTTSMLSDKEYLNLTQEDNLTGNLLTAIVTGT
NTRVDHTNDFDIPTETIAVDCGEVVWDTEAPVAVVNTPYPSVPRISGITFDVELLTYELT
TSLSELLDNPAAPFHQDTTTPLSEVIGFPPISSDADSSTSLSELLGMAATSLDTDSSNTP
LKLRPVSTKEPITSLSELLGLPPETLDLDIALSKDETTSSLPELLDELGDLFNNLAEAEL
KIDLTPEEFSSDLSISSMFSEETIDYAILKTDAKIEVSSELKIRTNITEFASFLDIDTDS
SIVFTPRTPKWAYVSWYVSETHKEVLRKKGGRLLAVRLYDATDIDLSYQTPQLVQQYECE
EATCDRYIDIPTSNRDYITEIGYTTDNNCWLGIARSGTIRIFNPPSEDFWFVTDTELVIH
GSTEPGAKVTIDDHEIEIQPDGTFNFRVPFSNSLLQYLMTATAARGEQTITILKKFSQEN
PED
Download sequence
Identical sequences D7DWY1
gi|298491100|ref|YP_003721277.1| WP_013191171.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]