SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491139|ref|YP_003721316.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491139|ref|YP_003721316.1|
Domain Number 1 Region: 668-768,795-823
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000628
Family HD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491139|ref|YP_003721316.1|
Sequence length 893
Comment 7TM receptor with intracellular metal dependent phosphohydrolase ['Nostoc azollae' 0708]
Sequence
MKTQQFWQSLTQQLRQWRRQYKVLYRQVKRLGSVSNSKSGTGNKKVFRNIFRTIFKNLLL
YLLPTTDQGGHRQARKAPQSTAKSFKTHHGFHAVVFSWLHEKRSAVILFMAVVSITGVMG
HELYNQPQMKIGTIAPQTFIAPYTASIENRQQTEADRKVAKTNTHAILMINTRKNEQINE
HLRQILEDGNELRGVAGSFPFFDVSILSVPNQRYLRSCLESEWQRLKVALANYQKQNNKL
LMPKSRTADRLVFSRPMPSPLLPLSTPAIKEESKISKPDFDQALAELGAYSITAPNKNFS
LLITQISQIRQGYVQATAKLLQIETQRKQAVYAATLLLDLSDEDWIKTQMGIHESAERIL
TQGIAPGVPFSILQDAVSLQVQKSVPDEAESLATKVLLAVLRPNLQQDEEKTKQQAEIAA
DQVPTVMEKVRQGQVIVNKGERITEWKSDVLEYYHLIRRELNWLALIGVTGLVSAALGVF
AWVDRRLGNHLRERDRLLILLLTLSIPSVLAMGVPYTTWSAIGLLLGSFYGSNLSVTVVL
LLSLILPVSIGISKIVLLAGAAGGILSSYLAQRFKSREELALLGIVIALTQGSIYLVLNI
LIGAAFGSGWYIVLQDSLLFALSGLAWSIIALGLSPYLEKLFDLVTPIRLAELANPNRPL
LKRLATETPGTFQHTLFVATLAEAAAKKLRCNVELVRAGTLYHDIGKMHDPLGFIENQMG
SPNKHETEIKDPWQSATIIKKHVTEGLVMAKKHSLPTVIQAFIPEHQGTMAITYFYHQAQ
EMAKDNPSIIVNKADFCYDGPIPQSRETGIVMLADSCEAALRSLKDATPEQALNMLNNII
RGKWQDEQLIDSGLTKEEMSKVAQIFVDVWQQFHHKRIAYPKLKASSEKSGND
Download sequence
Identical sequences D7DX20
WP_013191210.1.25658 gi|298491139|ref|YP_003721316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]