SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491306|ref|YP_003721483.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491306|ref|YP_003721483.1|
Domain Number 1 Region: 2-160
Classification Level Classification E-value
Superfamily Globin-like 2.38e-56
Family Phycocyanin-like phycobilisome proteins 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491306|ref|YP_003721483.1|
Sequence length 161
Comment phycocyanin ['Nostoc azollae' 0708]
Sequence
MSIVTKAIVNADAEARYLSPGELNRIKSFVAGGSQRLRIAQVLTDNRESIVKQAGNQLFQ
KRPDVVSPGGNAYGQEMTATCLRDLDYYLRLVTYGIVSGDVTPIEEIGIVGVREMYRSLG
TPIEAVAGGVTAMKSVASTLLSAEDAAEAGSYFDYVVGAMG
Download sequence
Identical sequences D7DY32
gi|298491306|ref|YP_003721483.1| WP_013191377.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]