SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491409|ref|YP_003721586.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491409|ref|YP_003721586.1|
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1e-33
Family Ribosomal proteins L24p and L21e 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491409|ref|YP_003721586.1|
Sequence length 115
Comment 50S ribosomal protein L24 ['Nostoc azollae' 0708]
Sequence
MAKPEPKVFHKMHVKTGDTVQVIAGKDKGKVGEVIKALPQLSKVLVKGVNIKTKHVKPQQ
EGESGKIVTQEFPIHSSNVMLYSSKQNIASRVCYTFTAEGKKVRMLQKTGEILDK
Download sequence
Identical sequences D7DYY4
WP_013191480.1.25658 gi|298491409|ref|YP_003721586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]