SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491482|ref|YP_003721659.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491482|ref|YP_003721659.1|
Domain Number 1 Region: 102-219
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.84e-37
Family NlpC/P60 0.00000179
Further Details:      
 
Domain Number 2 Region: 7-76
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 5.58e-24
Family Spr N-terminal domain-like 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491482|ref|YP_003721659.1|
Sequence length 225
Comment NLP/P60 protein ['Nostoc azollae' 0708]
Sequence
MSNPKLEEYQCIADINLYDSPECVGLATQAAAGRNLRITSNHQDAAVEVYLCEDDYPGWV
AVNDLFLLQPATVPYDAAFFSELDIKKLLPEVIAFTQQAMQQTNYYLWGGTVGPNYDCSG
LIQRAFVSVGVWLPRDAYQQEAFTQPIDINELQAGDLIFFGTRQKATHVGLYLGDGFYIH
SSGKEQGHNGIGIDQLSEQGDKVSQSYYKQLRGAGRVVRSYVGNS
Download sequence
Identical sequences D7DZQ4
gi|298491482|ref|YP_003721659.1| WP_013191552.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]