SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491532|ref|YP_003721709.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491532|ref|YP_003721709.1|
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000000123
Family Bacterial dinuclear zinc exopeptidases 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491532|ref|YP_003721709.1|
Sequence length 138
Comment peptidase M28 ['Nostoc azollae' 0708]
Sequence
MKKWLWLILLMLVTTIALMGSTSFFPHPETLPIVETTPKQQPQPQPQNKNTNTLLVSADR
LLAHIRKLNFQRYTPKERSHRARYITNELQKSGWKPQIEKLPTGVNIFAQKQGKDKGAGA
ILIAAHYDTVDLSPGADY
Download sequence
Identical sequences D7DZV4
gi|298491532|ref|YP_003721709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]