SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491583|ref|YP_003721760.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491583|ref|YP_003721760.1|
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily BolA-like 2.62e-25
Family BolA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491583|ref|YP_003721760.1|
Sequence length 78
Comment BolA family protein ['Nostoc azollae' 0708]
Sequence
MITPQQVEEMIKAELPDAQVQVQDLTGGGDHYQVTVVSSQFAGKGLVKQHQLVYVALQQA
MSTEAIHALALKTSTPEA
Download sequence
Identical sequences D7E0I1
gi|298491583|ref|YP_003721760.1| WP_013191653.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]