SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491622|ref|YP_003721799.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491622|ref|YP_003721799.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily HAD-like 1.21e-46
Family beta-Phosphoglucomutase-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491622|ref|YP_003721799.1|
Sequence length 211
Comment HAD superfamily hydrolase ['Nostoc azollae' 0708]
Sequence
MTQKVIIFDFDGTIADTVEALVSIANRLAIEFDYIQITPNELTLLRNLTSREIIRYSGVS
LLKIPFLFKKVKSELKNKITELEPISGVKEALIELNQKGYRLGVITSNSQENVTEFLRFH
NLNYLFEFLYSGVTIFGKTTIINNVLRQKQLKPETVIYVGDETRDIEAAKKANIKVIAVS
WGFNSPEALAKQNPDFLIHHPSELLDVVKLC
Download sequence
Identical sequences D7E0M0
WP_013191692.1.25658 gi|298491622|ref|YP_003721799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]