SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491623|ref|YP_003721800.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491623|ref|YP_003721800.1|
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000172
Family 7-Fe ferredoxin 0.086
Further Details:      
 
Weak hits

Sequence:  gi|298491623|ref|YP_003721800.1|
Domain Number - Region: 129-158
Classification Level Classification E-value
Superfamily Coronavirus RNA-binding domain 0.0706
Family Coronavirus RNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491623|ref|YP_003721800.1|
Sequence length 323
Comment iron-sulfur cluster-binding protein ['Nostoc azollae' 0708]
Sequence
MNQCALNSSLVKEKAKEFGFHKVGIAAIEGIEKKDAQRLQAWTQLGYHAQMEWMKNPQRQ
DIRLVMPDVRSLVCVALNYYTPDQRPEGEEYAKISRYGWGRDYHKIMHKKLKQLATWLES
LSEGIKARYYADTGPVQDKVWAERAGIGWIAKNGNVITREYGSWVFLGEVLTNIQLENDR
QATQHCGTCTKCIQACPTGAITQPFVVDAKKCIAYHTIENRADTLPESLTPHLHGWVAGC
DICQDVCPWNQRFAQVTDVTDFQPYNGNLAPKLVELAQISEEEWDKRFPASALRRIKPEM
LRRNACANLDASRLKNDPESNNI
Download sequence
Identical sequences D7E0M1
WP_013191693.1.25658 gi|298491623|ref|YP_003721800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]