SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491667|ref|YP_003721844.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298491667|ref|YP_003721844.1|
Domain Number - Region: 39-100
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000942
Family Apolipoprotein A-I 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491667|ref|YP_003721844.1|
Sequence length 107
Comment hypothetical protein Aazo_2894 ['Nostoc azollae' 0708]
Sequence
MDSNNWLEQLMMLGIGTTSLVAEKLRQVSDELVKDGKLNPEQAKVLMNDIVQQLKSEQGN
WELQMQRQMRNMMQDLGVARQSEVDELRGRIDRLERELRNLENKLWR
Download sequence
Identical sequences D7E0R5
WP_013191737.1.25658 gi|298491667|ref|YP_003721844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]