SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491721|ref|YP_003721898.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491721|ref|YP_003721898.1|
Domain Number 1 Region: 47-359
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 429-512,544-573
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000148
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 3 Region: 333-423
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000753
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|298491721|ref|YP_003721898.1|
Domain Number - Region: 585-669
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0148
Family P22 tailspike protein 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491721|ref|YP_003721898.1|
Sequence length 823
Comment filamentous hemagglutinin family outer membrane protein ['Nostoc azollae' 0708]
Sequence
MKVTFSIFALISVVLTSVTYNSRVQAKVTPDSKLKTTVTGSNNYTITNGNRVGNNLFHSF
SEFSIPTNGSAFFDNANDIQNIFSRVTGGNLSNIDGLIQANGSANLFLLNPSGIIFGANA
RLDIGGSFVGTTGNSIKFADGTEFSAVNASSSPLLTMSVPIGLQMGQDSGAITVQGLGHR
IIPPFSVAQELDLSNNPTGLQVKAGNTLALIGSGLNFAGGIVAADGGGHIEIGSINHGLV
RLNSTVTGWKGDYSQVEQFNDIHLAQQSLLDASGSNGSIQLQGQNINLTEGSTVVIQNLG
TQSQGITVHATGSLNLTGYTPDQKQGSIIAIENLGTSSSGDIVVSANQLFVQDGGQIQTF
TPTAAASGNISIDVEDLIYLNGFIPTNPTVNTKIITITDGSGKAGDITISSGSLKVFNGA
SLISVTMGYGEGGAMQINAKDLIEIVGNNPIILVPSAISSATIGTGNANSILVNTSRLIL
RDGGVLGSNTLSQGRAGNVTVNASDFLEVSGKAPGSIRSSNIMSSSEILDQVVQETYGLP
SIPTGDAGFLTINTPSLRISDSAFVSVKNDGPGRAGDLQINANLLFLYKEGSISASTASG
NGGDIQLNLQDYLLMYQDSVISATAQGNGNGGNLSINSPVIVGLENSDIIANAVQGRGGN
INISTQNIIGLEFRDILTPRTVPTNDITASSQFNVNGTVQINNISIVPSSGLVELPANIT
DPSQQIAIGCADTSGSSFVATGRGGIPQNPTQEVRSDKPWSDVRDLSSYRTTAQVQAQVL
QSRANFIQATSWHRNSQGKIELVVDKSSMSMQPSLTCVAVPKS
Download sequence
Identical sequences D7E198
gi|298491721|ref|YP_003721898.1| WP_013191791.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]