SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491727|ref|YP_003721904.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491727|ref|YP_003721904.1|
Domain Number 1 Region: 343-496
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2e-21
Family HD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298491727|ref|YP_003721904.1|
Sequence length 733
Comment glycyl-tRNA synthetase subunit beta ['Nostoc azollae' 0708]
Sequence
MPAFLLEVGTEELPASFLSSAIVQWRSRIPQTLEANNLKTETVEVYGTPRRLAVLITGLP
SQQPDKEEEIKGPSAQAAFKDGKPTPGAVGFAKKQGVELDAFEIRPTEKGDFVFIQKKTP
GRPVAEILTELFPQWVWSLEGKRLMRWGSGDGRFSRPIRWLVALLDGDVLPLELKNGDKT
VKSDRISQAHRVLHPEPVSISHATEYVNTLRSGYVIVSPEERENIITEQVKTAVQKLGGF
TPIYPDLLEETTNLVEYPTAVVGKFEDEFLLLPTEVSTTVMVNHQRYFPVFKTSENHELL
PNFITVSNGDPTKSDIIAVGNEKVIRARLADGRFFYKADLAKPLESFLPQLETVTFQEDL
GSVRAKVERVVNIAARISQQLQLGNNERQKIQRAALLCKADLVTQMVSEFPELQGTMGEK
YALASAEDSEVALAIYEHYLPRYASDNFPRTITGKVVALADRLDTLVSIFGLGLKPSGSS
DPFALRRAANAIIKIICSQSSDSTHQDYKDGLTLDLAGLLEQTATEFAAAFNKDRDSLIK
VLQDFFIQRIRTLFQEAEVQIFIDEIDYDLVNAVLGENDPEYTERALQDLLDVRDRALYL
QQIRNNGTLDKIYETVNRSTRLAAQGNLNFQQLEPTAVVKPELFQKSSESAFYNALLELV
PQTQAAQRTRNYQILIAALEKIAPTVSKLFDGEDSVLVMDLNPEIKRNRLNLLGLLRNHA
RVLADFGAIVKNL
Download sequence
Identical sequences D7E1A4
WP_013191797.1.25658 gi|298491727|ref|YP_003721904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]