SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491762|ref|YP_003721939.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491762|ref|YP_003721939.1|
Domain Number 1 Region: 39-212
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.92e-72
Family HD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 201-417
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.21e-63
Family RelA/SpoT domain 0.0000167
Further Details:      
 
Domain Number 3 Region: 400-472
Classification Level Classification E-value
Superfamily TGS-like 5.89e-22
Family TGS domain 0.079
Further Details:      
 
Domain Number 4 Region: 672-751
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000889
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491762|ref|YP_003721939.1|
Sequence length 758
Comment (p)ppGpp synthetase I ['Nostoc azollae' 0708]
Sequence
MSSLLLDSSVHVSLPEWLKKCLRETPVKTSTAEDNRMHSDIALICHAFQFAYQLHQGQYR
KSGEAYIAHPVAVAGLLRDLGGSPAMIGAGFLHDVVEDTEVTIEEIEEHFGAEVRQLVEG
VTKLSKINFTSKTESQAENFRRMFLAMAQDIRVIVVKLADRLHNMRTLQYMSEASRRRSA
QETRDIFAPLANRLGIWRVKWELEDLAFKYLEPDAFREIQQHVSEKRTAREEKLARATEV
LRKRMQQAGIQCLDVSGRPKHLYSIYQKMHRQHKEFHEIYDLAALRIIVQTNEECYRALA
VVHDAFRPIPGRFKDYIGLPKPNRYQSLHTGVIGLTGRPLEVQIRTMEMHHVAEYGIAAH
WKYKETGGSTNSQLTGTDEKFTWLRQLLEWQSDLKDAQEYLDSVKDNLFEDDVYVFTPKG
DVVPLSPGSTSIDFAYRIHTEVGNHCAGARVNGRIVPLSTRLHNGDIVDIITQKNSHPSL
DWLNFVRTSAAKYRIKQWYKRSRREENVSRGRDLLEKELGKTGFDHLLKSNAMHTVAEKC
NYHSVEDLLAGLGYGEITLNLVLNRWRDVVKAQQPMADVMSFILKESTSKTSRDTPPITS
RASDSPIIGVEGLLYHIAGCCTPIPGEAIIGVVTRGRGISIHRQGCHNVDNVECERLVPV
RWNTAIENSGRPYTYPVDIQIETLDRVGILKDILSRLSDQGINVRHANVKTALGQPALMD
LGIDICDRSQLEHLFVQIKKMSDILNIRRIGQVEDSQV
Download sequence
Identical sequences D7E1D9
WP_013191831.1.25658 gi|298491762|ref|YP_003721939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]