SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491800|ref|YP_003721977.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491800|ref|YP_003721977.1|
Domain Number 1 Region: 2-290
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.26e-77
Family AstE/AspA-like 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491800|ref|YP_003721977.1|
Sequence length 292
Comment Aspartoacylase ['Nostoc azollae' 0708]
Sequence
MNPINRLAIVGGIHGNELIGVYLVKKFQKYPHLINRNSFESLALLGNLQAILARRRYVDI
DLNRCFIGDNLPATKSSIYEELRAKEIQAILQPENQEFVDVIIDLHTTTANMGLCIIIGN
IHPLLLGLAAYLSAINPLVKVYIHQQARNSGFLRSLCQLGFSIEVGAVAQGTLDGELFKQ
TENLVYAVLDYFEDFNKGKNPLIQNSVTVYRASGVVNYPRNEDGDIAAMIHPQLQFRDYQ
PLYSGDPLFLTFESKEIFYEGESTVHPIFINEAAYYEKGIAMYLSQKELIHI
Download sequence
Identical sequences D7E1T3
WP_013191869.1.25658 gi|298491800|ref|YP_003721977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]