SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491867|ref|YP_003722044.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491867|ref|YP_003722044.1|
Domain Number 1 Region: 514-713
Classification Level Classification E-value
Superfamily TPR-like 1.1e-50
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Weak hits

Sequence:  gi|298491867|ref|YP_003722044.1|
Domain Number - Region: 116-300
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0157
Family Apolipoprotein A-I 0.0068
Further Details:      
 
Domain Number - Region: 274-453
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0654
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491867|ref|YP_003722044.1|
Sequence length 743
Comment hypothetical protein Aazo_3209 ['Nostoc azollae' 0708]
Sequence
MNSKKPIFSKLTLRSAILLSPLLICTSFLSGKLELSATAQVISNQEREELTRLRTENRIQ
KQVQSDFERAFTRTNTLLNIWLTILSLFPVVLIATVWFLRKAIIQEIIERSMQQIEGIDK
LQTQLLTVNQDAGNLIQTSQYLTQELAQEVNRLKQAIQGEEENLSILLSDLPKSKQEFLT
ALEREVESAQENISNLEFKLNTQLEQVTLSAQQQKINIENVRKLQADLVSKFTQVNLEVF
HQKDTAVNDIEQSRSQFISLLHGLESETLQHKEQTFESLSKYQSNFSEQLSQFQLDTQNK
KNVFIAHLEELNNLLKSRIAELEIDEQNQKDNLVATLVKLQLELSKQVSEIQNTAQLRQQ
EIIGNLEASASEFTAQFSDIQSDLEQQKLKILQRFENLESEFINEVAALQNDAQVRQQEI
IDNLEASGNEFTTQFSDIQSDIQQQELRILHKLDNLEKLESELVDKLSKILLDAHQRKNA
ILQESVEIKPQPTPELQTIPEEKQLEISADHDIKEAEIIFLEKRFDEALAIYERVVKIKP
DDAEIWLKRGLTLSRLKRYKDAIISYNQAIKINPDYHQAWCDIGVACGNLGKHQEAYNCF
DKATQIKPDDGVAWFNRGLSLLELENYEDAISSFDKALEFQPNSPKIWDKRGYTLVRLGQ
DDEAITNFDKALEINPHYPSAYYNKAACFALQREVPLALENLQKAIQIKPSYREDAATDI
EFNDFNKDFRFQQLIKGEYGGRE
Download sequence
Identical sequences D7E200
gi|298491867|ref|YP_003722044.1| WP_013191936.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]