SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491907|ref|YP_003722084.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298491907|ref|YP_003722084.1|
Domain Number - Region: 7-63
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000671
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491907|ref|YP_003722084.1|
Sequence length 67
Comment hypothetical protein Aazo_3275 ['Nostoc azollae' 0708]
Sequence
MVEFENHEQRPFNLFEEQMTNPKAIMLVLEVENEIVGYSFTRLEESSFVDIIPAPVWLHD
IYIALID
Download sequence
Identical sequences D7E2D9
gi|298491907|ref|YP_003722084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]