SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492229|ref|YP_003722406.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492229|ref|YP_003722406.1|
Domain Number 1 Region: 134-277
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-48
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00017
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-35
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492229|ref|YP_003722406.1|
Sequence length 279
Comment UDP-3-0-acyl N-acetylglucosamine deacetylase ['Nostoc azollae' 0708]
Sequence
MHQHTLAAEVIQKGVGLHSGVSSSLRILPAEPGSDRYFVRVDLPNSPIIPATVAAVNQTL
LSTQLGTEEVYVRTVEHLLAALSAMGVDNARIEIDGSEVPLLDGSAQVWTDSIAAVGLVL
QPVCDKQSPIFIKEPLWVHQGDAFIYAIPAPETRFSYGIDFDLPAIGNQWHSWSLSTNLE
NTFITEIAPARTFGLLHQIEYLQKSGLIKGGTLDNALVCGSDGWVNPPLRFANEPVRHKI
LDLVGDISLLGKFPLAHFLAYKASHNLHIQLAQKILESF
Download sequence
Identical sequences D7E465
WP_013192297.1.25658 gi|298492229|ref|YP_003722406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]