SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492251|ref|YP_003722428.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298492251|ref|YP_003722428.1|
Domain Number - Region: 94-189
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 0.0226
Family Cofactor-dependent phosphoglycerate mutase 0.051
Further Details:      
 
Domain Number - Region: 33-108
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0654
Family Calcium ATPase, transmembrane domain M 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492251|ref|YP_003722428.1|
Sequence length 279
Comment hypothetical protein Aazo_3768 ['Nostoc azollae' 0708]
Sequence
MHLLMILTAVTVAYSLRYFANIPQGNWHLRWERTLFLFLFPPLLIFMTATAVVCMGTQGK
MGGMYTNSSSYLLALIFLVLFNILGIKLTFQGWKSIKSARQCPQINLAGKQVRLLQTAAL
FAGQMGFWQPELVLSQGLLDTLSPAHLESVLAHEQGHYQYRDTFWFFWLGWMRSCTACLP
NTESLWQELLMLRELRADSYAASQVDPLVLAESLLLVVNSQPLASEVCCAALGSSGVDRL
EQRIDALLTPPETTPEAQLQSWHIFLFAFLPLLTVVFHT
Download sequence
Identical sequences D7E487
WP_013192319.1.25658 gi|298492251|ref|YP_003722428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]