SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492283|ref|YP_003722460.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492283|ref|YP_003722460.1|
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.77e-42
Family GHMP Kinase, N-terminal domain 0.0000392
Further Details:      
 
Domain Number 2 Region: 167-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.5e-24
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492283|ref|YP_003722460.1|
Sequence length 320
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase ['Nostoc azollae' 0708]
Sequence
MRSYSLIAPAKINLYLEIIGNRPDGYHELAMILQSIDIADQINLQAASTEEIHVYCNHPQ
VPADQSNLAYRAAELMARQFPDVFSNFGGIDITVTKRIPVAAGLAGGSTNAAAVLVGIDL
LWDLGLTKSELEELGATLGSDVSFCISGGTAIATGRGELLSPLPSLNQIHLVLAKYLSLE
VSTPWAYKTYRQEFGNSYVKNTEDLVARANAVHSGEMVKAILDKDAAKISQKLHNDLEKV
VLPAYPQVLQLRELFATQEGVLGTMMSGSGPSVFAIVESKAQAEIVKQQIRTAIPDEDLE
LFVTQTIANGIQILQGTGNR
Download sequence
Identical sequences D7E4B9
gi|298492283|ref|YP_003722460.1| WP_013192350.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]