SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492317|ref|YP_003722494.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298492317|ref|YP_003722494.1|
Domain Number - Region: 70-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000999
Family Archaeal DNA-binding protein 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492317|ref|YP_003722494.1|
Sequence length 134
Comment hypothetical protein Aazo_3858 ['Nostoc azollae' 0708]
Sequence
MTTANYTNPKPFVYSQITVERAKRSLICSPFRLALFLTMQIKSVPVSAIAMENGIKQGYT
QRPLSELVCDNHLNWLIQVGILRREVDGQGITDSFRLTPLGHQLLEKLQKQELCIPTLSD
HLYDAFIRWVRLPF
Download sequence
Identical sequences D7E4Q5
WP_013192384.1.25658 gi|298492317|ref|YP_003722494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]