SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492409|ref|YP_003722586.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492409|ref|YP_003722586.1|
Domain Number 1 Region: 315-339,374-425,464-589
Classification Level Classification E-value
Superfamily HAD-like 3.3e-41
Family Meta-cation ATPase, catalytic domain P 0.00076
Further Details:      
 
Domain Number 2 Region: 133-229
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.29e-20
Family Calcium ATPase, transduction domain A 0.0023
Further Details:      
 
Domain Number 3 Region: 50-127,230-321,627-686
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000353
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492409|ref|YP_003722586.1|
Sequence length 709
Comment K+-transporting ATPase subunit B ['Nostoc azollae' 0708]
Sequence
MNSATTTPRPKSPRSRPSDRRQKRKKVRVSTKLLYTRVIRDTFIKLYPKYAIQNPVMFLV
WLATTTTLAATIYPPLFGPVTQKNPQLFNGLLTLILFSTVIFANFAEALAEGRGKAQADA
LRSTRSETIAKKIVVDGTITEISSTTLKQGDTVYVVAGDMIPADGEVILGIASVDESAIT
GESAPVLKESGSDVSSSVTGGTRIISDELIIRITADPGKGFIDRMIDLVEGAECTKTPNE
IALTVLLAVLTTAFFIVVATLPVFAYYVKSPVSIPVLIALLVALIPTTIGGLLSAIGIAG
MDRVAQFNLIATSGRVVEACGDINTLVLDKTGTITLGNRLAEAFLPINAHSMAEIANVAL
GASIFDDTPEGKSIVRLAEKCGAKFDIDRKKCQGVEFSATTRMSGTNLPGGHEVRKGAVG
AIKGFVRSRRGSSGASHNGNETPELVTAYEAVSHQGGTPLLVCLDNEIYGVIYLKDIVKP
GIHERFDQLRRMGVRTVMLTGDNRITASVIAKEAGVDEFIAKATPEDKVSIIQREQAEGK
VVAMTGDGTNDALALAQADVGIAMNTGTKSAKEAANMVDLDSDPTKLVDIVSIGKQLLIT
RGALTIFSIANDIAKYFAIIPVIFAAANLNSLNIMKLTSVNSAILSALIYNALIIPALIP
LALKGVKFRPWTANQLLQRNILIYGLGGVIVPFIAIKFIDMLITFAGLA
Download sequence
Identical sequences D7E5A3
gi|298492409|ref|YP_003722586.1| WP_013192475.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]