SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492507|ref|YP_003722684.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492507|ref|YP_003722684.1|
Domain Number 1 Region: 96-144
Classification Level Classification E-value
Superfamily ENT-like 0.0000497
Family Emsy N terminal (ENT) domain-like 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|298492507|ref|YP_003722684.1|
Domain Number - Region: 47-112
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.00811
Family EspA-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492507|ref|YP_003722684.1|
Sequence length 152
Comment hypothetical protein Aazo_4124 ['Nostoc azollae' 0708]
Sequence
MSKCDLLKSRSSKVKLEPEVAIAIMGLFSASADGEGIIPTEEYPLAEMLEGIGVFEEYAE
EDFDQLTAKVNTLREKEKAENLIPSAIASLTKKNYRETAYITAILVVGMEEDISESDQDY
LFELQEVLKISDERAEELIDEVFEEYEEEEEE
Download sequence
Identical sequences D7DVZ0
WP_013192572.1.25658 gi|298492507|ref|YP_003722684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]