SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492521|ref|YP_003722698.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492521|ref|YP_003722698.1|
Domain Number 1 Region: 290-436
Classification Level Classification E-value
Superfamily Flavoproteins 5.5e-37
Family Flavodoxin-related 0.0054
Further Details:      
 
Domain Number 2 Region: 448-597
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.45e-36
Family NADH:FMN oxidoreductase-like 0.003
Further Details:      
 
Domain Number 3 Region: 40-281
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.87e-31
Family ROO N-terminal domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492521|ref|YP_003722698.1|
Sequence length 601
Comment flavin reductase domain-containing FMN-binding protein ['Nostoc azollae' 0708]
Sequence
MELPDSFSNAFASAKNWFSQVFSPQQTSKKSMSDSKPRDVQVLPIATNTKVLRARSWSRL
RFEIEYALERGTTSNCYLIEADNTALIDPPGESFTTIYLEALQNTVNFRKLDYVIMGHFS
PNRIPTLKALLELAPQITFVCSLLGANNLRASFPDQDIKVLVMRGKETLDLGKGHVLKFL
PTPSPRWPEALCTYDQQTQILYTDKLFGVHICGDQVFDDNVESFKEDQRYYFNCLMAPHA
THVEAALEKISDLQVRMYAVGHGPLVRTGLIELTKAYGEWSHSQKNREISVALLYASAYG
NTAILAQAMALGLTKGGVAVHSINCEFAPPDEIRHTVEQADALIIGTPTIGGHAPTPIHT
ALGIVLATGDSSKLAGVFGSYGWSGEALDLVECKLRDAGYRFGFDTLKVKFKPDEVTLKM
CEEIGTDFAQGLKKARKIRVPQQAATPTEQAVGRIIGSVCVVSAKQGEVSTGMLGAWVSQ
ATFNPPGITVAIAKDRAVESLMYPGGKFVLNILPEGVHVDYMKHFRKNFTPGEDRFANFQ
TVDADNGCTVLTDASAYLECSVNQRLECGDHWVVYATVDNGKLLKPDAITAINHRKTGTH
Y
Download sequence
Identical sequences D7DW04
gi|298492521|ref|YP_003722698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]