SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492523|ref|YP_003722700.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492523|ref|YP_003722700.1|
Domain Number 1 Region: 346-546
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.85e-49
Family Ppx associated domain 0.0019
Further Details:      
 
Domain Number 2 Region: 150-332
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.62e-40
Family Ppx/GppA phosphatase 0.0012
Further Details:      
 
Domain Number 3 Region: 23-146
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.62e-36
Family Ppx/GppA phosphatase 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492523|ref|YP_003722700.1|
Sequence length 557
Comment Ppx/GppA phosphatase ['Nostoc azollae' 0708]
Sequence
MLNAVSANWESTPTQPVKQNPIIAAIDIGTNSLHIVIVRIEPTLPAFTMIAREKETVRLG
ERNLETGELKPEVIRKAIACLGRFQKLAKSLEAESIIAVATSAVREAPNGQDFLQNIESE
IGLSVDLISGQEEARRIYLGVLSGMEFNHEPHIIIDIGGGSTELILGDSQDPRSLTSTKV
GAVRLTGELINTDPISHCEFQYLQAYAKGMLERSVEDVLFKLKPGESPKLVGTSGTIETL
ATIHAKEKMGVVPSTLNGYQFSLQDLRTWVTRLRRMTNVERAAISGMPEKRSEVILAGAV
ILQEAMTLLDVDSVSLCERSLREGVIVDWMLTHGFIDNKLRYQSSIRERNVLKIAKKYHI
NLENSNACGDHSDHIAKFALSLFDQTQSQLHNWGQQERQLLWAAAILHNCGHYISHSSHH
KHSYYLIRNGELLGYNETEIEIIANLARYHRKSPPKKKHDNYRNLLHKEHRLIVSQLSAI
LRLSVALDRRQIGAISQVQCEYIPQKHEFKILLFPRILGDDCALELWSLDYKKGVFEEEF
GLKLDANLVNTCSVNFP
Download sequence
Identical sequences D7DW06
gi|298492523|ref|YP_003722700.1| WP_013192588.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]