SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492548|ref|YP_003722725.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492548|ref|YP_003722725.1|
Domain Number 1 Region: 13-52
Classification Level Classification E-value
Superfamily Cell growth inhibitor/plasmid maintenance toxic component 0.00000194
Family Kid/PemK 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492548|ref|YP_003722725.1|
Sequence length 56
Comment MazE/toxin transcriptional modulator MazF ['Nostoc azollae' 0708]
Sequence
MIDSNATNIFAPVTKVSQIFTLDKTFLVERIGSLPDYLQEEVDQGLRTLLYLNYLS
Download sequence
Identical sequences D7DW31
gi|298492548|ref|YP_003722725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]