SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492557|ref|YP_003722734.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492557|ref|YP_003722734.1|
Domain Number 1 Region: 10-167
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 1.24e-58
Family Bacterial fluorinating enzyme, N-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 173-264
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 1.44e-23
Family Bacterial fluorinating enzyme, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492557|ref|YP_003722734.1|
Sequence length 269
Comment hypothetical protein Aazo_4209 ['Nostoc azollae' 0708]
Sequence
MFQEQMIRSKILTLLSDFGDKDVYVGVMKGVIAQINPYLILIDLTHQIPAQNIAAARFCL
MNAYDYFPKGTVHLAVVDPGVGSQRRAIALKLEQGYLVGPDNGIFSGITSKNQIITAIEL
TNPNFWRTSEPSSTFNGIDIFAPVAAHLGNGVSLQELGTEINPETVVMDIGECWETTNGV
TGYIQYIDHFGNLVSNIPASYVKDKNWCVQIAGLTILGCAAYSDVEIGEALALVGSHGWV
EIAINSGNAQIKLQVNWQDGLEVLFLQSC
Download sequence
Identical sequences D7DW40
gi|298492557|ref|YP_003722734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]