SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492671|ref|YP_003722848.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492671|ref|YP_003722848.1|
Domain Number 1 Region: 428-448,490-749
Classification Level Classification E-value
Superfamily HAD-like 9.9e-59
Family Meta-cation ATPase, catalytic domain P 0.00023
Further Details:      
 
Domain Number 2 Region: 234-330
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.55e-27
Family Calcium ATPase, transduction domain A 0.0055
Further Details:      
 
Domain Number 3 Region: 4-67
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.19e-18
Family HMA, heavy metal-associated domain 0.00093
Further Details:      
 
Domain Number 4 Region: 177-234,331-424,691-724
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000000123
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492671|ref|YP_003722848.1|
Sequence length 759
Comment copper-translocating P-type ATPase ['Nostoc azollae' 0708]
Sequence
MDNLTLKLRGMSCASCANNVEQAILAVPGVIDCSVSFGAEQATINYDEKQTNVEKIQAAI
DAAGYSSFSLLEEQDEDDSEQVIRLAEQQELKRKLWTCSVISSLLFFGSLPMMMGLSLSF
VPDYLHHPWLQLVLTTPVEFWCGWSFFRNGCKSLKHHTATMDTLIALGTGAAYLYSLVVT
LFPDFFITQGLQTHVYYEVAAMVVTLILLGRFLEHRARGQTSEAICKLMGMQAETARVMR
DEVEIDIPIKDVKINDVVLVRPGETIPVDGEVIDGSSTVDEAMVTGGSLPVKKQPGDEVI
GATINKTGSFKFRATRVAKDTFLAQIVRLVQEAQGSKAPIQRLADQVTGWFVPGVIAIAI
ATFVIWFNLTGNFTLAMMTMVGVLIIACPCALGLATPTSVMVGTGKGAENGILIKDAQSL
ESAHKIQTIVLDKTGTLTQGKPTVTDFATVQGTVNQNELELLKLAASVERNSEHPLAEAV
VKYAEFQEVSLAEVEDFVAIAGSGVQGIVNDHLLQIGTERWLTELGINTDSLQEYQPGWE
VGGKTVILIAIDGQLEGIMGIADALKPSSAKAVKALQKLGLEVVMLTGDNRATADAVAHQ
VGITQVFAQVRPDQKAAIIKSLQHWGLGKKIQHRKSKIVAMVGDGINDAPALVQADVGIA
IGTGTDVAMAASDITLISGDLEAIVTAIQLSRATMNNIQQNLLFAFIYNIIGIPIAAGIL
YPIFGWLLNPIIAGAAMAFSSVSVVTNALRLRNFQAGIN
Download sequence
Identical sequences D7DWR2
gi|298492671|ref|YP_003722848.1| WP_013192735.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]