SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492820|ref|YP_003722997.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492820|ref|YP_003722997.1|
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000667
Family Apolipoprotein A-I 0.014
Further Details:      
 
Weak hits

Sequence:  gi|298492820|ref|YP_003722997.1|
Domain Number - Region: 96-264
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0017
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492820|ref|YP_003722997.1|
Sequence length 275
Comment hypothetical protein Aazo_4655 ['Nostoc azollae' 0708]
Sequence
MTNNIKEKIQADLQEAKGTGQLRTENIREIVKTAVSQIASELKEGSSELRTLVKDAVSTV
IENLQDKGGEIKEEVTVAIEGALEAVNTKRHDAIVKTQTELKQIQAKLDDEEEQLQKEVE
GMLTEIEHTSQDKSANTKTALASAINGIQDSEEVALLKKRYAHLQAQLAIIRANLAARYG
GRSVEIKEYLDDAQTWYNQVHPQAEMMVKQVEEKHSQLDNKLGELGVSIARRERGLKQSL
RELLLTTADLFKDKEAGNKETLVKKQVKIQESEDV
Download sequence
Identical sequences D7DXP8
WP_013192884.1.25658 gi|298492820|ref|YP_003722997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]