SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492878|ref|YP_003723055.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492878|ref|YP_003723055.1|
Domain Number 1 Region: 488-807
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.27e-81
Family Extended AAA-ATPase domain 0.00000000723
Further Details:      
 
Domain Number 2 Region: 161-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.72e-75
Family Extended AAA-ATPase domain 0.0000000511
Further Details:      
 
Domain Number 3 Region: 3-137
Classification Level Classification E-value
Superfamily Double Clp-N motif 4.51e-31
Family Double Clp-N motif 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298492878|ref|YP_003723055.1|
Sequence length 824
Comment ATPase AAA-2 domain-containing protein ['Nostoc azollae' 0708]
Sequence
MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR
IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA
ARVLENLGVDLSKVRTQVIRMLGETAEVSPGGGSSGRTKTPTLDEFGSNLTQMATDNKLD
PVVGRAKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLASRIANKDVPDILEDKRVV
TLDIGLLVAGTKYRGEFEERLKKIMDEIRSAGNVILVIDEVHTLIGAGAAEGAIDAANIL
KPALARGELQCIGATTLDEYRKHIERDAALERRFQPVMVGEPSVDETIEILYGLRDRYEQ
HHKLKISDEALVAAAKLSDRYISDRYLPDKAIDLVDEAGSRVRLINSQLPPAAKELDKEL
RQILKEKDDAVRSQDFDRAGELRDREMEIKAEIRTIAQTKTNAAGGDGVEPVVTEEDIAH
IVASWTGVPVNKLTESESEKLLHMEDTLHQRLIGQDDAVKAVSRAIRRARVGLKNPNRPI
ASFVFSGPTGVGKTELAKSLASYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNE
GGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMLLQILEDGRLTDAKGRTVDFKNTLLILTS
NIGSKVIEKGGSGIGFEFAEDATESQYNRIRSLVNEELKQYFRPEFLNRLDEIIVFRQLN
KLEVTQIAEIMLKEVFGRLTEKGITLEVSDRFKERLVQEGYSPSYGARPLRRAIMRLLED
SLAEEILSGRIKDGDTALVDVDENGIVQVSSQPRRELLPQGVES
Download sequence
Identical sequences D7DXV6
WP_013192942.1.25658 gi|298492878|ref|YP_003723055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]