SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492921|ref|YP_003723098.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492921|ref|YP_003723098.1|
Domain Number 1 Region: 91-220,253-450
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000432
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492921|ref|YP_003723098.1|
Sequence length 513
Comment hypothetical protein Aazo_4806 ['Nostoc azollae' 0708]
Sequence
MTKSYKFIQPLDRVVIALMILLSLLIGFVIWQGDAVKPIVRNFTWQNQQIGAEDTAFTLT
FSRPMDTKSVEENLKVCPVETKSEEENSTTCPVLAGKISWAGRRLVYTLVTPAPYGTTYK
VSLQGATDRFSQKEGKKREIQPFTGSFITRDRALLYIGANQQEQGKLVIYNLTQGQKKVL
TPKELIVMDFEPFPHGEKILFSARSSKNPDILSAQLYTVTTGISSTTGQQPQPPGKLDLI
LDNKHYQNLKFDLSPDGATIVVQRGKIDNPGDFGLWHLLTTQDSSGTKPTAKRLQTQPPG
DFLITPDSKAVAVAQGQGTAILSLQGEATKPLDFLPQFGLVQAFSKDGSQAAMVKFNTDF
TRDLFLVTNQGVQKQLLKTTGSILDCNFDPASPTLYCLLTQLISKEQYIEQPYLVAINLK
TDQQKPLLMLPPAQRNVHMSLAPDGLGLVFDQIVPIENSTTTLPANTLKTDDGEPIATSS
LWLMPLLPITDVANIEIKPEQLPLVGFHPHWLP
Download sequence
Identical sequences D7DY97
WP_013192985.1.25658 gi|298492921|ref|YP_003723098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]