SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492944|ref|YP_003723121.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298492944|ref|YP_003723121.1|
Domain Number - Region: 224-283
Classification Level Classification E-value
Superfamily PhoU-like 0.0279
Family PhoU-like 0.015
Further Details:      
 
Domain Number - Region: 59-101
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0549
Family Proton glutamate symport protein 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298492944|ref|YP_003723121.1|
Sequence length 298
Comment hypothetical protein Aazo_4850 ['Nostoc azollae' 0708]
Sequence
MSKNNQPSKKPYQKNIPIWKMTIIQVLKGTIGVLENTVVQLETDTPVSTEKKPNFLQRVL
SSWDGFLRTFRLFLPSNVSNNLSDTILTGILVGVAVVIVGTTTVFILKPSEVGTLPPVKK
VTAPTPIPTVAVLPEPEITTTPEPTPTLEATPTLEATPTLEATPTLEPKLEPEPIPTPIL
QLTPEQALIAAIEDQLAEISVSLTRNGEEIISTKLIKSIQANFRSSDLTVKIADDWYALE
TDKQNQLAADILQRSQELDFTHLEILDYQDNLIARNPVVGNEMVILKRRSLIVPKLAS
Download sequence
Identical sequences D7DYC0
gi|298492944|ref|YP_003723121.1| WP_013193008.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]