SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298492969|ref|YP_003723146.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298492969|ref|YP_003723146.1|
Domain Number 1 Region: 155-312
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.53e-44
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000393
Further Details:      
 
Domain Number 2 Region: 54-147
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.23e-25
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00023
Further Details:      
 
Domain Number 3 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 5.91e-19
Family TS-N domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298492969|ref|YP_003723146.1|
Sequence length 314
Comment translation elongation factor Ts ['Nostoc azollae' 0708]
Sequence
MAEISAKLVQELRQKTGAGMMDCKKALKETEGNIDEAIDWLRKKGIAKADKASDRIAAEG
LVDTYIQPDAQVGVLIELNCQTDFVARNEAFKSLVKNLAKQAATADSVESLLAQPYIEDT
SVTVEQFIKQVIATLGENIQVRRFVNFSPAPGVSGIVDSYIHTGGRVGVLVELNAQTQSA
IGNEDFQSLARNTAMQVAACPNVEYVSIDQIPAEVVTKEKDIEMGKDDLGKKPENIKEKI
VQGRIDKRLKEMTLLDQPYIRDQSISVEELVKQVKSKVGEDIQVHRFVRYVLGEGIEKQE
ISFAEEVAAQMGAK
Download sequence
Identical sequences D7DYE5
gi|298492969|ref|YP_003723146.1| WP_013193033.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]