SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298493021|ref|YP_003723198.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493021|ref|YP_003723198.1|
Domain Number 1 Region: 4-252
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.22e-90
Family Tryptophan biosynthesis enzymes 0.000000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298493021|ref|YP_003723198.1|
Sequence length 268
Comment tryptophan synthase subunit alpha ['Nostoc azollae' 0708]
Sequence
MTTTISRCFETLRRNHECALIPFITAGDPDLETTGKALQVLDRSGADIIELGVPYSDPLA
DGPVIQAAATRALERGTTLDQVLAMLHATTPGLQAPIVLFTYYNPILHRGIEKFLEQIKA
AGVAGLVVPDLPLEEAAGLLEPASEVGIDLTLLVAPTSSAQRIKAIARASQGFIYLVSVT
GVTGMRNQMESRVSDLLTQIRSVTDKPIGVGFGIWETEQARQVREWGADAAIVGSAIVKR
LAEGTPEAGLDAIAEFCHNLKSGIKTTS
Download sequence
Identical sequences D7DZ54
gi|298493021|ref|YP_003723198.1| WP_013193085.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]