SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298493031|ref|YP_003723208.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493031|ref|YP_003723208.1|
Domain Number 1 Region: 14-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.48e-58
Family PP-loop ATPase 0.00025
Further Details:      
 
Domain Number 2 Region: 214-321
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 6.8e-21
Family MesJ substrate recognition domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298493031|ref|YP_003723208.1|
Sequence length 324
Comment tRNA(Ile)-lysidine synthetase ['Nostoc azollae' 0708]
Sequence
MTWTAIHAEIHCTIRARHLFARNQKLLVAVSGGQDSLCLIKLLLDLQPKWKWSLAIAHCD
HCWREDSQANAHHVENLAHNWHTPFYLETATNPVKNEASARNWRYQALTKIAEVHNYQYI
VTGHTASDRAETLLYNLMRGTGADGLQALTWQRPLNENIILVRPLLEVTRSQTEQFCQEF
NLPIWQDSTNQNLQYARNRIRQELIPYLKENFNPQVESNLAQTAELLLAEVEYLEQTAHQ
LRLEASEKGENDILQLNRPILKRVPLALQRRVMRQVLQKILPDAPNFEHIEKLRVLITAP
NRSQTDPFPGGAIAQVQGDWIFIS
Download sequence
Identical sequences D7DZ64
gi|298493031|ref|YP_003723208.1| WP_013193095.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]