SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298493200|ref|YP_003723377.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298493200|ref|YP_003723377.1|
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily Flavoproteins 8.38e-41
Family NADPH-dependent FMN reductase 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298493200|ref|YP_003723377.1|
Sequence length 181
Comment NADPH-dependent FMN reductase ['Nostoc azollae' 0708]
Sequence
MVKIVGIGGSLRPGSYTQLGLQVAAQRVAALGTEVEILDLRQMQLPFCTGAKEYPEYPDV
QRLRDTVGNSDGLILATPEYHGGVSGVIKNTLDLMSFDQLSGKVIGLVSILGGQSNSNAL
NDLRIIMRWVHGWVIPEQIAIGQAYSAFSPEGKLLDEKLSQRFDQFAQSLVDNTRKLREV
N
Download sequence
Identical sequences D7E0T5
gi|298493200|ref|YP_003723377.1| WP_013193263.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]