SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491404|ref|YP_003721581.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491404|ref|YP_003721581.1|
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.31e-39
Family Ribosomal protein S3 C-terminal domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.07e-31
Family Prokaryotic type KH domain (KH-domain type II) 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491404|ref|YP_003721581.1|
Sequence length 251
Comment 30S ribosomal protein S3 ['Nostoc azollae' 0708]
Sequence
MGQKIHPVGFRLGITQEHQSRWFAVPDRYPELLQEDHKLRKYIDQKLGRYAQNNAGISEV
RIERKADQIDLEVRTARPGVVVGRGGQGIESLRTGLQELLGSNRQIRINVVEVQRVDADA
YLIAEYIAQQLERRVSFRRVVRQAIQRAQRAGVQGIKVQVSGRLNGAEIARTEWTREGRV
PLHTLRADIDYSYCTAQTIYGILGIKVWVFKGEIIPGQEETPAQPTTREREPRRRQQQRR
RQQFEDRSNEA
Download sequence
Identical sequences D7DYX9
WP_013191475.1.25658 gi|298491404|ref|YP_003721581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]