SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491460|ref|YP_003721637.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491460|ref|YP_003721637.1|
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.23e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 333-458
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.16e-34
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 231-325
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.89e-34
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298491460|ref|YP_003721637.1|
Sequence length 463
Comment nucleotide sugar dehydrogenase ['Nostoc azollae' 0708]
Sequence
MRVCVIGTGYVGLVTGACLAYIGHDVICIDNNEEKVKLMKSGQSPIFEPGLSEIMQSAIN
SRNIQFSSDLPAGVAHGEILFIAVGTPPLPNGESDTRYVEAVARGIGANLNGGYKVIVNK
STVPIGSGDWVRMIVLDGIAERQKTLIPISGSSCEEKLPEISAQFDVVSNPEFLREGSAV
YDTFNPDRIVLGGNSLQAIGMMKDLYAPIVERKFAADQSLPPVPVLVTDLSSAEMIKYAA
NAFLATKISFINEVANICDRVGADVTQVAKGIGLDSRIGNKFLQAGIGWGGSCFPKDVSA
LIHTADDYGYEAQLMKAAVSVNERQRLIALEKLQQALKILKGKTVGLLGLTFKPDTDDLR
DAPALNLIEQLNRLGAKVKAYDPIISQTGMRHGLSGVLVETDAERLADSCDALVLVTEWQ
QFSTLDYGKMARLMNHAVMIDGRNFLDPEAMVRDGFQYVGVGR
Download sequence
Identical sequences D7DZN2
WP_013191530.1.25658 gi|298491460|ref|YP_003721637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]