SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298491495|ref|YP_003721672.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298491495|ref|YP_003721672.1|
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-56
Family Protein kinases, catalytic subunit 0.0000942
Further Details:      
 
Domain Number 2 Region: 406-523
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.57e-29
Family Pentapeptide repeats 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298491495|ref|YP_003721672.1|
Sequence length 533
Comment serine/threonine protein kinase ['Nostoc azollae' 0708]
Sequence
MSYCFNPTCAHPKNLSSSQRCNSCGSPLLLRDRYQIIKRLGQGGFGATFVAVDEVLPGEP
CCVIKQLRPSGTAPHILQMARDLFEREAKTLGKIGNHPHIPRLLDYFEEETQFYLVQEYI
SGATLQQEVKKTGFYSEAGVKQFLTEILPLLQYIHDLKVIHRDIKPANLIRRTQDARLVL
IDFGAVKNQVSQIPPNQSGQTALTAYAIGTPGFAPPEQMAMRPVYSSDIYALGVTCIYLL
TGKTPKDIPYNPTTGEMMWEQMVNMSGHLTTVLKKMLEVSIRNRYQSASDVLRAMGMEPY
LDSLAKGLIVKTETDSRDKIQNRPENPGNLSSNPTSGSNDGVAQLAAAIRARRAKSPETS
GLRAGRNQNKQLISKPSSAANSDLSGSQINRRLNSETLLKAYLKGRRDFACFNISLLNLE
GADLSGTNFHSAQLRKTNLQGANLENTDFGRASLMQTNLRDANLTKAYLSHADLEGADLR
GADLSYAYISQANLRGTNLCGANLTGAKVTDEQLALAKINWLTVRPNGKRGFL
Download sequence
Identical sequences D7DZR7
WP_013191565.1.25658 gi|298491495|ref|YP_003721672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]